PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g14520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CPP
Protein Properties Length: 385aa    MW: 43009.1 Da    PI: 7.6709
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g14520genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.92.6e-1568107242
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                ++kgC+C++skClk+YC+Cfa+g+ C++ C C dC+N+ e+
  Tp3g14520  68 KQKGCRCRQSKCLKLYCDCFASGVLCND-CDCADCHNNPEN 107
                89**************************.********9875 PP

2TCR49.86.8e-16150186440
        TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                +gC+Ck++kClkkYCeCf+a++ Cs++CkC dC N +
  Tp3g14520 150 RGCKCKRTKCLKKYCECFQANALCSDNCKCIDCGNVS 186
                79********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.0E-1767107IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.7268187IPR005172CRC domain
PfamPF036383.7E-1269104IPR005172CRC domain
SMARTSM011144.6E-15147188IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.9E-12150184IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MIGNADSGAI ATEKNPRELV FTKLELSLVV PESPVRELSL FPPISRGEPS ETPETKDKAD  60
QKGITWRKQK GCRCRQSKCL KLYCDCFASG VLCNDCDCAD CHNNPENSDV REAAMVSVLD  120
RNPNAFNRRL LSFPIDKQAA PDTKLGLLSR GCKCKRTKCL KKYCECFQAN ALCSDNCKCI  180
DCGNVSEGAQ PSVFARTRSS LQVYQRRRYR ELPERNSCPA PLSSMPVGSI LNSLDSPMYS  240
SPKLPYRKKR SWLGYTTKLI PDLGDLSSLL LAASESATAN AGLEDQKRIC IKPDDKKDKI  300
GIELWNESES GIVEEDIQSC GRLIELIDAQ YNGEVESQCY ETKTSAHETD IYMQQERAVL  360
ETFRDCLNKY IKIGFMKGTT NSILL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406870.10.0hypothetical protein EUTSA_v10022304mg, partial
SwissprotQ700D00.0TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLV4M7I20.0V4M7I2_EUTSA; Uncharacterized protein (Fragment)
STRINGAT3G16160.11e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148441520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16160.11e-154Tesmin/TSO1-like CXC domain-containing protein